PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00088.135
Common NameAMTR_s00088p00164440, LOC18427655
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family WRKY
Protein Properties Length: 647aa    MW: 70701.8 Da    PI: 6.2718
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00088.135genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.96.5e-31259316260
                                               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                                      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                                               +Dg+nWrKYGqK+vkgsefprsYY+Ct+++C+vkk +ers  d+++++i Y+g+H+h+k
  evm_27.model.AmTr_v1.0_scaffold00088.135 259 EDGFNWRKYGQKQVKGSEFPRSYYKCTYPNCQVKKIMERSL-DGRITDINYKGQHDHPK 316
                                               7****************************************.***************85 PP

2WRKY106.41.4e-33436494159
                                               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                                      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                               ldDgy+WrKYGqK+vkg+++prsYY+Ct agCpv+k+ver+++dpk v++tYeg+Hnh+
  evm_27.model.AmTr_v1.0_scaffold00088.135 436 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNAGCPVRKHVERASHDPKSVITTYEGKHNHD 494
                                               59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.1E-26253317IPR003657WRKY domain
SuperFamilySSF1182901.01E-23257317IPR003657WRKY domain
SMARTSM007741.3E-33258316IPR003657WRKY domain
PfamPF031067.8E-23259315IPR003657WRKY domain
PROSITE profilePS5081122.148259317IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.9E-38421496IPR003657WRKY domain
SuperFamilySSF1182901.44E-29428496IPR003657WRKY domain
PROSITE profilePS5081138.985431496IPR003657WRKY domain
SMARTSM007741.4E-39436495IPR003657WRKY domain
PfamPF031062.1E-26437494IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 647 aa     Download sequence    Send to blast
MATHLEQERE REDEGERSPS SEPEEQSHHR EDKKEEREEE RDGNLQRVGH GGLGSRGLGG  60
LSTARYKALS PANLPIGRSS CPPILSPSAM LDSPVLLSNM QHAEPSPTTG SFMLPPFLYN  120
AVKPDPGSSK PDDSKPCHDE DGGSAWFVFK PHIKSGQPSL GDLASSSTNY QQCEKLSQVQ  180
TQSLTSSVDV TSAKNEHVAL TEHELSLSIT SPTLPSHMAS SQVNGSNGVS SEELQARQCS  240
SSGIQKGSSP LTVVERSSED GFNWRKYGQK QVKGSEFPRS YYKCTYPNCQ VKKIMERSLD  300
GRITDINYKG QHDHPKPQPS RRLAVGSVQA IQEGEERSEL FRSSINAEDK SSNAQGQFCN  360
YMDPNGTPEL SSVSASEDDT ESGSVQANKT RDEVEDDDPE SKRRKREFSA VDSALLCRST  420
REPRVVVQTT SEVDILDDGY RWRKYGQKVV KGNPNPRSYY KCTNAGCPVR KHVERASHDP  480
KSVITTYEGK HNHDVPSGRA NTSENTFSAI SHSPPTPNSH PLAPQNLILG PTTTNQAEGT  540
KISYYDHSVS LDLGVGVGPG LDNRYLEKLR TLDSATSSIQ IDGLEVGKVI QATPISSLQG  600
GGSEVREGEP HNAVEKRKSF TFETPKPVYE ASGPYYQSMG RLLLGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-37247497178Probable WRKY transcription factor 4
2lex_A2e-37247497178Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006836767.10.0PREDICTED: probable WRKY transcription factor 20
TrEMBLW1NWG10.0W1NWG1_AMBTC; Uncharacterized protein
STRINGVIT_19s0090g01720.t011e-158(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.11e-101WRKY family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]